Lineage for d1pu3a_ (1pu3 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1399946Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1399947Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1399948Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1399949Protein Amphibian cytotoxic ribonuclease [54084] (5 species)
  7. 1399963Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (10 PDB entries)
  8. 1399973Domain d1pu3a_: 1pu3 A: [95122]

Details for d1pu3a_

PDB Entry: 1pu3 (more details)

PDB Description: the solution nmr structure and dynamics of a recombinant onconase with altered n-terminal and met23 residues
PDB Compounds: (A:) P-30 protein

SCOPe Domain Sequences for d1pu3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pu3a_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30 [TaxId: 8404]}
mqdwltfqkkhitntrdvdcdnilstnlfhckdkntfiysrpepvkaickgiiasknvlt
tsefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

SCOPe Domain Coordinates for d1pu3a_:

Click to download the PDB-style file with coordinates for d1pu3a_.
(The format of our PDB-style files is described here.)

Timeline for d1pu3a_: