SCOP 1.67: Domain d1pu3a_: 1pu3 A:

Lineage for d1pu3a_ (1pu3 A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (1 family)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Amphibian cytotoxic ribonuclease [54084] (4 species)

7. Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (2 PDB entries)

8. Domain d1pu3a_: 1pu3 A: [95122]
   mutant

Details for d1pu3a_

PDB Entry: 1pu3

PDB Description: the solution nmr structure and dynamics of a recombinant onconase with altered n-terminal and met23 residues

SCOP Domain Sequences for d1pu3a_:

Sequence; same for both SEQRES and ATOM records:

>d1pu3a_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30}
mqdwltfqkkhitntrdvdcdnilstnlfhckdkntfiysrpepvkaickgiiasknvlt
tsefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

Timeline for d1pu3a_:

• d1pu3a_ is new in SCOP 1.67
  
• d1pu3a_ appears in SCOP 1.69
  
• d1pu3a_ appears in the current release, SCOPe 2.08, called d1pu3a1