Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (1 family) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins) |
Protein Amphibian cytotoxic ribonuclease [54084] (4 species) |
Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (2 PDB entries) |
Domain d1pu3a_: 1pu3 A: [95122] mutant |
PDB Entry: 1pu3 (more details)
SCOP Domain Sequences for d1pu3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pu3a_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30} mqdwltfqkkhitntrdvdcdnilstnlfhckdkntfiysrpepvkaickgiiasknvlt tsefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc
Timeline for d1pu3a_: