SCOPe 2.08: Domain d1pu3a1: 1pu3 A:2-105

Lineage for d1pu3a1 (1pu3 A:2-105)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Amphibian cytotoxic ribonuclease [54084] (5 species)

7. Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (10 PDB entries)

8. Domain d1pu3a1: 1pu3 A:2-105 [95122]
   Other proteins in same PDB: d1pu3a2

Details for d1pu3a1

PDB Entry: 1pu3

PDB Description: the solution nmr structure and dynamics of a recombinant onconase with altered n-terminal and met23 residues

PDB Compounds: (A:) P-30 protein

SCOPe Domain Sequences for d1pu3a1:

Sequence; same for both SEQRES and ATOM records:

>d1pu3a1 d.5.1.1 (A:2-105) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30 [TaxId: 8404]}
qdwltfqkkhitntrdvdcdnilstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

Timeline for d1pu3a1:

• d1pu3a1 first appeared in SCOP 1.67, called d1pu3a_
  
• d1pu3a1 appears in SCOPe 2.07