Lineage for d1ptzb_ (1ptz B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2763729Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2763832Species Human (Homo sapiens) [TaxId:9606] [49333] (96 PDB entries)
  8. 2763888Domain d1ptzb_: 1ptz B: [95111]
    complexed with cu1, so4, zn; mutant

Details for d1ptzb_

PDB Entry: 1ptz (more details), 1.8 Å

PDB Description: crystal structure of the human cu, zn superoxide dismutase, familial amyotrophic lateral sclerosis (fals) mutant h43r
PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d1ptzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ptzb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglrgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOPe Domain Coordinates for d1ptzb_:

Click to download the PDB-style file with coordinates for d1ptzb_.
(The format of our PDB-style files is described here.)

Timeline for d1ptzb_: