Class a: All alpha proteins [46456] (226 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (3 families) |
Family a.211.1.2: PDEase [48548] (6 proteins) Pfam 00233; multihelical; can be divided into three subdomains |
Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89152] (11 PDB entries) |
Domain d1ptwd_: 1ptw D: [95109] complexed with amp, zn |
PDB Entry: 1ptw (more details), 2.3 Å
SCOP Domain Sequences for d1ptwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ptwd_ a.211.1.2 (D:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens)} iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh plwetwadlvhpdaqdildtlednrewyqstipq
Timeline for d1ptwd_: