Lineage for d1ptwd_ (1ptw D:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 546038Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 546039Superfamily a.211.1: HD-domain/PDEase-like [109604] (3 families) (S)
  5. 546057Family a.211.1.2: PDEase [48548] (6 proteins)
    Pfam 00233; multihelical; can be divided into three subdomains
  6. 546090Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 546091Species Human (Homo sapiens) [TaxId:9606] [89152] (11 PDB entries)
  8. 546115Domain d1ptwd_: 1ptw D: [95109]
    complexed with amp, zn

Details for d1ptwd_

PDB Entry: 1ptw (more details), 2.3 Å

PDB Description: The Crystal Structure of AMP-Bound PDE4 Suggests a Mechanism for Phosphodiesterase Catalysis

SCOP Domain Sequences for d1ptwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ptwd_ a.211.1.2 (D:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens)}
iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
plwetwadlvhpdaqdildtlednrewyqstipq

SCOP Domain Coordinates for d1ptwd_:

Click to download the PDB-style file with coordinates for d1ptwd_.
(The format of our PDB-style files is described here.)

Timeline for d1ptwd_: