SCOP 1.67: Domain d1ptjc_: 1ptj C:

Lineage for d1ptjc_ (1ptj C:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein)
   binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode

6. Protein Transhydrogenase domain III (dIII) [52485] (3 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [52488] (6 PDB entries)

8. Domain d1ptjc_: 1ptj C: [95103]
   Other proteins in same PDB: d1ptja1, d1ptja2, d1ptjb1, d1ptjb2
   complexed with dI component
   complexed with gol, nap, snd

Details for d1ptjc_

PDB Entry: 1ptj, 2.61 Å

PDB Description: crystal structure analysis of the di and diii complex of transhydrogenase with a thio-nicotinamide nucleotide analogue

SCOP Domain Sequences for d1ptjc_:

Sequence; same for both SEQRES and ATOM records:

>d1ptjc_ c.31.1.4 (C:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum}
svkagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsyaihpvag
rmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdpsspiygm
pildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

Timeline for d1ptjc_:

• d1ptjc_ is new in SCOP 1.67
  
• d1ptjc_ appears in SCOP 1.69
  
• d1ptjc_ appears in the current release, SCOPe 2.08