Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 proteins) this domain interrupts the other domain which defines family |
Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species) L-alanine dehydrogenase homologue |
Species Rhodospirillum rubrum [TaxId:1085] [63938] (15 PDB entries) |
Domain d1ptjb1: 1ptj B:144-326 [95101] Other proteins in same PDB: d1ptja2, d1ptjb2, d1ptjc_ complexed with dIII component complexed with gol, nap, snd |
PDB Entry: 1ptj (more details), 2.61 Å
SCOPe Domain Sequences for d1ptjb1:
Sequence, based on SEQRES records: (download)
>d1ptjb1 c.2.1.4 (B:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv psr
>d1ptjb1 c.2.1.4 (B:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv raatkeqveslggkfitvddeamefrkkqaeavlkelvktdiaittalipgkpapvlite emvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvpsr
Timeline for d1ptjb1: