Lineage for d1ptjb1 (1ptj B:144-326)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2092885Family c.2.1.4: Formate/glycerate dehydrogenases, NAD-domain [51830] (10 protein domains)
    this domain interrupts the other domain which defines family
  6. 2092914Protein Nicotinamide nucleotide transhydrogenase dI component [63937] (1 species)
    L-alanine dehydrogenase homologue
  7. 2092915Species Rhodospirillum rubrum [TaxId:1085] [63938] (15 PDB entries)
  8. 2092941Domain d1ptjb1: 1ptj B:144-326 [95101]
    Other proteins in same PDB: d1ptja2, d1ptjb2, d1ptjc_
    complexed with dIII component
    complexed with gol, nap, snd

Details for d1ptjb1

PDB Entry: 1ptj (more details), 2.61 Å

PDB Description: Crystal structure analysis of the DI and DIII complex of transhydrogenase with a thio-nicotinamide nucleotide analogue
PDB Compounds: (B:) NAD(P) transhydrogenase subunit alpha part 1

SCOPe Domain Sequences for d1ptjb1:

Sequence, based on SEQRES records: (download)

>d1ptjb1 c.2.1.4 (B:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamktaetaggyakemgeefrkkqaeavlkelvktdiait
talipgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnv
psr

Sequence, based on observed residues (ATOM records): (download)

>d1ptjb1 c.2.1.4 (B:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
agyravidgayefarafpmmmtaagtvpparvlvfgvgvaglqaiatakrlgavvmatdv
raatkeqveslggkfitvddeamefrkkqaeavlkelvktdiaittalipgkpapvlite
emvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvpsr

SCOPe Domain Coordinates for d1ptjb1:

Click to download the PDB-style file with coordinates for d1ptjb1.
(The format of our PDB-style files is described here.)

Timeline for d1ptjb1: