Lineage for d1ptja2 (1ptj A:1-143,A:327-371)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2440267Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2440331Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 protein domains)
  6. 2440337Protein Nicotinamide nucleotide transhydrogenase dI component [63963] (1 species)
    L-alanine dehydrogenase homologue
  7. 2440338Species Rhodospirillum rubrum [TaxId:1085] [63964] (15 PDB entries)
  8. 2440363Domain d1ptja2: 1ptj A:1-143,A:327-371 [95100]
    Other proteins in same PDB: d1ptja1, d1ptjb1, d1ptjc_
    complexed with dIII component
    complexed with gol, nap, snd

Details for d1ptja2

PDB Entry: 1ptj (more details), 2.61 Å

PDB Description: crystal structure analysis of the di and diii complex of transhydrogenase with a thio-nicotinamide nucleotide analogue
PDB Compounds: (A:) NAD(P) transhydrogenase subunit alpha part 1

SCOPe Domain Sequences for d1ptja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ptja2 c.23.12.2 (A:1-143,A:327-371) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]}
mkiaipkerrpgedrvaispevvkklvglgfeviveqgagvgasitddaltaagatiast
aaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgaltnrpvvealtkrkitay
amelmprisraqsmdilssqsnlXvaadasplfaknllnfltphvdkdtktlvmkledet
vsgtcvtrd

SCOPe Domain Coordinates for d1ptja2:

Click to download the PDB-style file with coordinates for d1ptja2.
(The format of our PDB-style files is described here.)

Timeline for d1ptja2: