SCOP 1.71: Domain d1pt9b_: 1pt9 B:

Lineage for d1pt9b_ (1pt9 B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein)
   binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode

6. Protein Transhydrogenase domain III (dIII) [52485] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52486] (2 PDB entries)

8. Domain d1pt9b_: 1pt9 B: [95098]
   complexed with gol, so4, tap

Details for d1pt9b_

PDB Entry: 1pt9, 2.42 Å

PDB Description: crystal structure analysis of the diii component of transhydrogenase with a thio-nicotinamide nucleotide analogue

SCOP Domain Sequences for d1pt9b_:

Sequence; same for both SEQRES and ATOM records:

>d1pt9b_ c.31.1.4 (B:) Transhydrogenase domain III (dIII) {Human (Homo sapiens)}
pmeisgthteinldnaidmireansiiitpgyglcaakaqypiadlvkmlteqgkkvrfg
ihpvagrmpgqlnvllaeagvpydivlemdeinhdfpdtdlvlvigandtvnsaaqedpn
siiagmpvlevwkskqvivmkrslgvgyaavdnpifykpntamllgdakktcdalqakvr
es

Timeline for d1pt9b_:

• d1pt9b_ first appeared in SCOP 1.67
  
• d1pt9b_ appears in SCOP 1.69
  
• d1pt9b_ appears in SCOP 1.73
  
• d1pt9b_ appears in the current release, SCOPe 2.08