Lineage for d1pt9a_ (1pt9 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470834Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2470835Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2471108Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins)
    binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
    automatically mapped to Pfam PF02233
  6. 2471109Protein Transhydrogenase domain III (dIII) [52485] (3 species)
  7. 2471112Species Human (Homo sapiens) [TaxId:9606] [52486] (3 PDB entries)
  8. 2471115Domain d1pt9a_: 1pt9 A: [95097]
    complexed with gol, so4, tap

Details for d1pt9a_

PDB Entry: 1pt9 (more details), 2.42 Å

PDB Description: crystal structure analysis of the diii component of transhydrogenase with a thio-nicotinamide nucleotide analogue
PDB Compounds: (A:) NAD(P) transhydrogenase, mitochondrial

SCOPe Domain Sequences for d1pt9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pt9a_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Human (Homo sapiens) [TaxId: 9606]}
pmeisgthteinldnaidmireansiiitpgyglcaakaqypiadlvkmlteqgkkvrfg
ihpvagrmpgqlnvllaeagvpydivlemdeinhdfpdtdlvlvigandtvnsaaqedpn
siiagmpvlevwkskqvivmkrslgvgyaavdnpifykpntamllgdakktcdalqakvr
es

SCOPe Domain Coordinates for d1pt9a_:

Click to download the PDB-style file with coordinates for d1pt9a_.
(The format of our PDB-style files is described here.)

Timeline for d1pt9a_: