![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily) consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit |
![]() | Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) ![]() |
![]() | Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 proteins) forms interlocked homodimer of two ring-like subunits |
![]() | Protein Hypothetical protein YfdW [102709] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102710] (6 PDB entries) |
![]() | Domain d1pt8b_: 1pt8 B: [95096] structural genomics complexed with aco, gol, oxl |
PDB Entry: 1pt8 (more details), 2.2 Å
SCOPe Domain Sequences for d1pt8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pt8b_ c.123.1.1 (B:) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]} stplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyft mlnsnkrsielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinprlif gsikgfdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligll aallhrektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavpr ggnaggggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystahar qphifdifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveveq plrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhai
Timeline for d1pt8b_: