SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1pt8a_ (1pt8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150853Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 2150854Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. 2150855Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 protein domains)
    forms interlocked homodimer of two ring-like subunits
  6. 2150912Protein Hypothetical protein YfdW [102709] (1 species)
  7. 2150913Species Escherichia coli [TaxId:562] [102710] (6 PDB entries)
  8. 2150920Domain d1pt8a_: 1pt8 A: [95095]
    structural genomics
    complexed with aco, gol, oxl

Details for d1pt8a_

PDB Entry: 1pt8 (more details), 2.2 Å

PDB Description: Crystal structure of the yfdW gene product of E. coli, in complex with oxalate and acetyl-CoA
PDB Compounds: (A:) Hypothetical protein yfdW

SCOPe Domain Sequences for d1pt8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pt8a_ c.123.1.1 (A:) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]}
mstplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyf
tmlnsnkrsielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinprli
fgsikgfdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligl
laallhrektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavp
rggnaggggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystaha
rqphifdifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveve
qplrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhai

SCOPe Domain Coordinates for d1pt8a_:

Click to download the PDB-style file with coordinates for d1pt8a_.
(The format of our PDB-style files is described here.)

Timeline for d1pt8a_: