SCOPe 2.06: Domain d1pt8a_: 1pt8 A:

Lineage for d1pt8a_ (1pt8 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
   consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit

4. Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families)

5. Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 protein domains)
   forms interlocked homodimer of two ring-like subunits

6. Protein Hypothetical protein YfdW [102709] (1 species)

7. Species Escherichia coli [TaxId:562] [102710] (6 PDB entries)

8. Domain d1pt8a_: 1pt8 A: [95095]
   structural genomics
   complexed with aco, gol, oxl

Details for d1pt8a_

PDB Entry: 1pt8, 2.2 Å

PDB Description: Crystal structure of the yfdW gene product of E. coli, in complex with oxalate and acetyl-CoA

PDB Compounds: (A:) Hypothetical protein yfdW

SCOPe Domain Sequences for d1pt8a_:

Sequence; same for both SEQRES and ATOM records:

>d1pt8a_ c.123.1.1 (A:) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]}
mstplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyf
tmlnsnkrsielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinprli
fgsikgfdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligl
laallhrektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavp
rggnaggggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystaha
rqphifdifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveve
qplrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhai

Timeline for d1pt8a_:

• d1pt8a_ first appeared in SCOP 1.67
  
• d1pt8a_ appears in SCOPe 2.05