SCOPe Funding Alert: SCOPe support from the NIH
ended in April 2016. John-Marc Chandonia is the primary
maintainer and has continued to develop SCOPe using vacation
time. Three proposals to the NIH for continued funding have been
unsuccessful. If our current NIH proposal is not funded,
SCOPe will shut down permanently in Summer 2017
as Dr. Chandonia will need to seek a new position.
Lineage for d1pt8a_ (1pt8 A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unitSuperfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) 
Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 protein domains)
forms interlocked homodimer of two ring-like subunits
Protein Hypothetical protein YfdW [102709] (1 species) Species Escherichia coli [TaxId:562] [102710] (6 PDB entries) 
Domain d1pt8a_: 1pt8 A: [95095]
structural genomics
complexed with aco, gol, oxl
Details for d1pt8a_
PDB Entry: 1pt8 (more details), 2.2 Å
PDB Description: Crystal structure of the yfdW gene product of E. coli, in complex with oxalate and acetyl-CoA
PDB Compounds: (A:) Hypothetical protein yfdWSCOPe Domain Sequences for d1pt8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pt8a_ c.123.1.1 (A:) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]}
mstplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyf
tmlnsnkrsielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinprli
fgsikgfdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligl
laallhrektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavp
rggnaggggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystaha
rqphifdifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveve
qplrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhai
SCOPe Domain Coordinates for d1pt8a_:
Click to download the PDB-style file with coordinates for d1pt8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pt8a_:
- d1pt8a_ first appeared in SCOP 1.67
- d1pt8a_ appears in SCOPe 2.05
View in 3D
