Lineage for d1pt7a_ (1pt7 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2529423Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 2529424Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. 2529425Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 proteins)
    forms interlocked homodimer of two ring-like subunits
  6. 2529482Protein Hypothetical protein YfdW [102709] (1 species)
  7. 2529483Species Escherichia coli [TaxId:562] [102710] (6 PDB entries)
  8. 2529485Domain d1pt7a_: 1pt7 A: [95093]
    structural genomics
    complexed with gol, po4

Details for d1pt7a_

PDB Entry: 1pt7 (more details), 1.8 Å

PDB Description: Crystal structure of the apo-form of the yfdW gene product of E. coli
PDB Compounds: (A:) Hypothetical protein yfdW

SCOPe Domain Sequences for d1pt7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pt7a_ c.123.1.1 (A:) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]}
stplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyft
mlnsnkrsielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinprlif
gsikgfdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligll
aallhrektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavpr
ggnaggggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystahar
qphifdifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveveq
plrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhai

SCOPe Domain Coordinates for d1pt7a_:

Click to download the PDB-style file with coordinates for d1pt7a_.
(The format of our PDB-style files is described here.)

Timeline for d1pt7a_: