Lineage for d1pt6b_ (1pt6 B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399192Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 399193Superfamily c.62.1: vWA-like [53300] (4 families) (S)
  5. 399194Family c.62.1.1: Integrin A (or I) domain [53301] (10 proteins)
  6. 399219Protein Integrin alpha1-beta1 [53310] (2 species)
  7. 399220Species Human (Homo sapiens) [TaxId:9606] [53311] (3 PDB entries)
  8. 399222Domain d1pt6b_: 1pt6 B: [95092]
    complexed with gol, mg

Details for d1pt6b_

PDB Entry: 1pt6 (more details), 1.87 Å

PDB Description: i domain from human integrin alpha1-beta1
PDB Compounds: (B:)

SCOP Domain Sequences for d1pt6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pt6b_ c.62.1.1 (B:) Integrin alpha1-beta1 {Human (Homo sapiens)}
ldivivldgsnsiypwdsvtaflndllkrmdigpkqtqvgivqygenvthefnlnkysst
eevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdgeshdnhrl
kkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdelalvt
ivktlgerifaleat

SCOP Domain Coordinates for d1pt6b_:

Click to download the PDB-style file with coordinates for d1pt6b_.
(The format of our PDB-style files is described here.)

Timeline for d1pt6b_: