SCOPe 2.08: Domain d1pt6b_: 1pt6 B:

Lineage for d1pt6b_ (1pt6 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)

6. Protein Integrin alpha1-beta1 [53310] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53311] (4 PDB entries)

8. Domain d1pt6b_: 1pt6 B: [95092]
   complexed with gol, mg

Details for d1pt6b_

PDB Entry: 1pt6, 1.87 Å

PDB Description: i domain from human integrin alpha1-beta1

PDB Compounds: (B:) integrin alpha-1

SCOPe Domain Sequences for d1pt6b_:

Sequence; same for both SEQRES and ATOM records:

>d1pt6b_ c.62.1.1 (B:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]}
ldivivldgsnsiypwdsvtaflndllkrmdigpkqtqvgivqygenvthefnlnkysst
eevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdgeshdnhrl
kkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdelalvt
ivktlgerifaleat

Timeline for d1pt6b_:

• d1pt6b_ first appeared in SCOP 1.67
  
• d1pt6b_ appears in SCOPe 2.07