SCOPe 2.08: Domain d1pt5b_: 1pt5 B:

Lineage for d1pt5b_ (1pt5 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
   consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit

4. Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families)

5. Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 proteins)
   forms interlocked homodimer of two ring-like subunits

6. Protein Hypothetical protein YfdW [102709] (1 species)

7. Species Escherichia coli [TaxId:562] [102710] (6 PDB entries)

8. Domain d1pt5b_: 1pt5 B: [95090]
   structural genomics
   complexed with aco

Details for d1pt5b_

PDB Entry: 1pt5, 2 Å

PDB Description: Crystal structure of gene yfdW of E. coli

PDB Compounds: (B:) Hypothetical protein yfdW

SCOPe Domain Sequences for d1pt5b_:

Sequence; same for both SEQRES and ATOM records:

>d1pt5b_ c.123.1.1 (B:) Hypothetical protein YfdW {Escherichia coli [TaxId: 562]}
stplqgikvldftgvqsgpsctqmlawfgadvikierpgvgdvtrhqlrdipdidalyft
mlnsnkrsielntktaegkevmeklireadilvenfhpgaidhmgftwehiqeinprlif
gsikgfdecspyvnvkayenvaqaaggaasttgfwdgpplvsaaalgdsntgmhlligll
aallhrektgrgqrvtmsmqdavlnlcrvklrdqqrldklgyleeypqypngtfgdavpr
ggnaggggqpgwilkckgwetdpnayiyftiqeqnwentckaigkpewitdpaystahar
qphifdifaeiekytvtidkheavayltqfdipcapvlsmkeisldpslrqsgsvveveq
plrgkyltvgcpmkfsaftpdikaapllgehtaavlqelgysddeiaamkqnhai

Timeline for d1pt5b_:

• d1pt5b_ first appeared in SCOP 1.67
  
• d1pt5b_ appears in SCOPe 2.07