Lineage for d1pt2a_ (1pt2 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 468754Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 468760Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (4 families) (S)
  5. 468772Family b.67.2.2: Levansucrase [101881] (1 protein)
  6. 468773Protein Levansucrase [101882] (1 species)
  7. 468774Species Bacillus subtilis [TaxId:1423] [101883] (2 PDB entries)
  8. 468776Domain d1pt2a_: 1pt2 A: [95086]

Details for d1pt2a_

PDB Entry: 1pt2 (more details), 2.1 Å

PDB Description: crystal structure of levansucrase (e342a) complexed with sucrose

SCOP Domain Sequences for d1pt2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pt2a_ b.67.2.2 (A:) Levansucrase {Bacillus subtilis}
qkpyketygishitrhdmlqipeqqknekyqvpefdsstiknissakgldvwdswplqna
dgtvanyhgyhivfalagdpknaddtsiymfyqkvgetsidswknagrvfkdsdkfdand
silkdqtqewsgsatftsdgkirlfytdfsgkhygkqtlttaqvnvsasdsslningved
yksifdgdgktyqnvqqfidegnyssgdnhtlrdphyvedkghkylvfeantgtedgyqg
eeslfnkayygkstsffrqesqkllqsdkkrtaelangalgmielnddytlkkvmkplia
sntvtdeiaranvfkmngkwylftdsrgskmtidgitsndiymlgyvsnsltgpykplnk
tglvlkmdldpndvtftyshfavpqakgnnvvitsymtnrgfyadkqstfapsfllnikg
kktsvvkdsileqgqltvnk

SCOP Domain Coordinates for d1pt2a_:

Click to download the PDB-style file with coordinates for d1pt2a_.
(The format of our PDB-style files is described here.)

Timeline for d1pt2a_: