Lineage for d1pt1b_ (1pt1 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802649Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2802650Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins)
  6. 2802651Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species)
    autocatalytic enzyme
  7. 2802652Species Escherichia coli [TaxId:562] [50695] (9 PDB entries)
  8. 2802660Domain d1pt1b_: 1pt1 B: [95085]
    Other proteins in same PDB: d1pt1a2
    unprocessed mutant
    complexed with so4

Details for d1pt1b_

PDB Entry: 1pt1 (more details), 1.9 Å

PDB Description: unprocessed pyruvoyl dependent aspartate decarboxylase with histidine 11 mutated to alanine
PDB Compounds: (B:) Aspartate 1-decarboxylase

SCOPe Domain Sequences for d1pt1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pt1b_ b.52.2.1 (B:) Pyruvoyl dependent aspartate decarboxylase, ADC {Escherichia coli [TaxId: 562]}
mirtmlqgklarvkvthadlhyegscaidqdfldaagileneaidiwnvtngkrfstyai
aaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemk

SCOPe Domain Coordinates for d1pt1b_:

Click to download the PDB-style file with coordinates for d1pt1b_.
(The format of our PDB-style files is described here.)

Timeline for d1pt1b_: