Lineage for d1pt0b_ (1pt0 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798408Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 1798462Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 1798463Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins)
  6. 1798464Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species)
    autocatalytic enzyme
  7. 1798465Species Escherichia coli [TaxId:562] [50695] (9 PDB entries)
  8. 1798482Domain d1pt0b_: 1pt0 B: [95083]
    unprocessed mutant
    complexed with so4

Details for d1pt0b_

PDB Entry: 1pt0 (more details), 2 Å

PDB Description: Unprocessed Pyruvoyl Dependent Aspartate Decarboxylase with an Alanine insertion at position 26
PDB Compounds: (B:) Aspartate 1-decarboxylase

SCOPe Domain Sequences for d1pt0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pt0b_ b.52.2.1 (B:) Pyruvoyl dependent aspartate decarboxylase, ADC {Escherichia coli [TaxId: 562]}
mirtmlqgklhrvkvthadlhyegsacaidqdfldaagileneaidiwnvtngkrfstya
iaaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemk

SCOPe Domain Coordinates for d1pt0b_:

Click to download the PDB-style file with coordinates for d1pt0b_.
(The format of our PDB-style files is described here.)

Timeline for d1pt0b_: