SCOP 1.75: Domain d1pt0b_: 1pt0 B:

Lineage for d1pt0b_ (1pt0 B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (1 protein)

6. Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species)
   autocatalytic enzyme

7. Species Escherichia coli [TaxId:562] [50695] (9 PDB entries)

8. Domain d1pt0b_: 1pt0 B: [95083]
   unprocessed mutant
   complexed with sul

Details for d1pt0b_

PDB Entry: 1pt0, 2 Å

PDB Description: Unprocessed Pyruvoyl Dependent Aspartate Decarboxylase with an Alanine insertion at position 26

PDB Compounds: (B:) Aspartate 1-decarboxylase

SCOP Domain Sequences for d1pt0b_:

Sequence; same for both SEQRES and ATOM records:

>d1pt0b_ b.52.2.1 (B:) Pyruvoyl dependent aspartate decarboxylase, ADC {Escherichia coli [TaxId: 562]}
mirtmlqgklhrvkvthadlhyegsacaidqdfldaagileneaidiwnvtngkrfstya
iaaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemk

Timeline for d1pt0b_:

• d1pt0b_ first appeared in SCOP 1.67
  
• d1pt0b_ appears in SCOP 1.73
  
• d1pt0b_ appears in SCOPe 2.01
  
• d1pt0b_ appears in the current release, SCOPe 2.08