Lineage for d1psya_ (1psy A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323688Fold a.52: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47698] (1 superfamily)
    4 helices; folded leaf; right-handed superhelix
  4. 2323689Superfamily a.52.1: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin [47699] (4 families) (S)
    can be classified as disulfide-rich
  5. 2323762Family a.52.1.3: Seed storage protein, 2S albumin [47715] (3 protein domains)
    two chains result from a single-chain precursor
  6. 2323763Protein 2S albumin RicC3 [101228] (1 species)
  7. 2323764Species Castor bean (Ricinus communis) [TaxId:3988] [101229] (1 PDB entry)
  8. 2323765Domain d1psya_: 1psy A: [95081]

Details for d1psya_

PDB Entry: 1psy (more details)

PDB Description: structure of ricc3, nmr, 20 structures
PDB Compounds: (A:) 2S albumin

SCOPe Domain Sequences for d1psya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1psya_ a.52.1.3 (A:) 2S albumin RicC3 {Castor bean (Ricinus communis) [TaxId: 3988]}
aefmeskgeregsssqqcrqevqrkdlsscerylrqsssrrstgeevlrmpgdenqqqes
qqlqqccnqvkqvrdecqceaikyiaedqiqqgqlhgeeservaqrageivsscgvrcmr
qtrtn

SCOPe Domain Coordinates for d1psya_:

Click to download the PDB-style file with coordinates for d1psya_.
(The format of our PDB-style files is described here.)

Timeline for d1psya_: