SCOP 1.71: Domain d1ps9a3: 1ps9 A:331-465,A:628-671

Lineage for d1ps9a3 (1ps9 A:331-465,A:628-671)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 proteins)

6. Protein 2,4-dienoyl-CoA reductase, middle domain [102187] (1 species)

7. Species Escherichia coli [TaxId:562] [102188] (1 PDB entry)

8. Domain d1ps9a3: 1ps9 A:331-465,A:628-671 [95078]
   Other proteins in same PDB: d1ps9a1, d1ps9a2
   complexed with cl, fad, fmn, fs4, mde, nap

Details for d1ps9a3

PDB Entry: 1ps9, 2.2 Å

PDB Description: the crystal structure and reaction mechanism of e. coli 2,4-dienoyl coa reductase

SCOP Domain Sequences for d1ps9a3:

Sequence; same for both SEQRES and ATOM records:

>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli}
intcigcnqacldqifvgkvtsclvnprachetkmpilpavqkknlavvgagpaglafai
naaarghqvtlfdahseiggqfniakqipgkeefyetlryyrrmievtgvtlklnhtvta
dqlqafdetilasgiXpnralaqplidsgktvhliggcdvameldarraiaqgtrlalei

Timeline for d1ps9a3:

• d1ps9a3 first appeared in SCOP 1.67
  
• d1ps9a3 appears in SCOP 1.69
  
• d1ps9a3 appears in SCOP 1.73
  
• d1ps9a3 appears in the current release, SCOPe 2.08