Lineage for d1ps9a2 (1ps9 A:466-627)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 688694Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 688695Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families) (S)
  5. 688696Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins)
  6. 688697Protein 2,4-dienoyl-CoA reductase, C-terminal domain [102177] (1 species)
  7. 688698Species Escherichia coli [TaxId:562] [102178] (1 PDB entry)
  8. 688699Domain d1ps9a2: 1ps9 A:466-627 [95077]
    Other proteins in same PDB: d1ps9a1, d1ps9a3
    complexed with cl, fad, fmn, fs4, mde, nap

Details for d1ps9a2

PDB Entry: 1ps9 (more details), 2.2 Å

PDB Description: the crystal structure and reaction mechanism of e. coli 2,4-dienoyl coa reductase
PDB Compounds: (A:) 2,4-dienoyl-CoA reductase

SCOP Domain Sequences for d1ps9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]}
vprtppidgidhpkvlsyldvlrdkapvgnkvaiigcggigfdtamylsqpgestsqnia
gfcnewgidsslqqagglspqgmqiprsprqivmlqrkaskpgqglgkttgwihrttlls
rgvkmipgvsyqkidddglhvvingetqvlavdnvvicagqe

SCOP Domain Coordinates for d1ps9a2:

Click to download the PDB-style file with coordinates for d1ps9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ps9a2: