Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families) |
Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins) |
Protein 2,4-dienoyl-CoA reductase, C-terminal domain [102177] (1 species) |
Species Escherichia coli [TaxId:562] [102178] (1 PDB entry) |
Domain d1ps9a2: 1ps9 A:466-627 [95077] Other proteins in same PDB: d1ps9a1, d1ps9a3 complexed with cl, fad, fmn, fs4, mde, nap |
PDB Entry: 1ps9 (more details), 2.2 Å
SCOP Domain Sequences for d1ps9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} vprtppidgidhpkvlsyldvlrdkapvgnkvaiigcggigfdtamylsqpgestsqnia gfcnewgidsslqqagglspqgmqiprsprqivmlqrkaskpgqglgkttgwihrttlls rgvkmipgvsyqkidddglhvvingetqvlavdnvvicagqe
Timeline for d1ps9a2: