Lineage for d1ps9a1 (1ps9 A:1-330)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2827870Protein 2,4-dienoyl-CoA reductase, N-terminal domain [102042] (1 species)
  7. 2827871Species Escherichia coli [TaxId:562] [102043] (1 PDB entry)
  8. 2827872Domain d1ps9a1: 1ps9 A:1-330 [95076]
    Other proteins in same PDB: d1ps9a2, d1ps9a3
    complexed with cl, fad, fmn, mde, nap, sf4
    has additional insertions and/or extensions that are not grouped together

Details for d1ps9a1

PDB Entry: 1ps9 (more details), 2.2 Å

PDB Description: the crystal structure and reaction mechanism of e. coli 2,4-dienoyl coa reductase
PDB Compounds: (A:) 2,4-dienoyl-CoA reductase

SCOPe Domain Sequences for d1ps9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]}
sypslfapldlgfttlknrvlmgsmhtgleeypdgaerlaafyaerarhgvalivsggia
pdltgvgmeggamlndasqiphhrtiteavhqeggkialqilhtgrysyqphlvapsalq
apinrfvphelsheeilqlidnfarcaqlareagydgvevmgsegylinefltlrtnqrs
dqwggdyrnrmrfavevvravrervgndfiiiyrlsmldlvedggtfaetvelaqaieaa
gatiintgigwheariptiatpvprgafswvtrklkghvslplvttnrindpqvaddils
rgdadmvsmarpfladaellskaqsgrade

SCOPe Domain Coordinates for d1ps9a1:

Click to download the PDB-style file with coordinates for d1ps9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ps9a1: