Lineage for d1pqva_ (1pqv A:)

  1. Root: SCOPe 2.07
  2. 2592940Class i: Low resolution protein structures [58117] (25 folds)
  3. 2595068Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 2595069Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 2595070Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 2595071Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 2595072Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries)
  8. 2595092Domain d1pqva_: 1pqv A: [95028]
    complexed with transcription elongation factor S-II
    protein/RNA complex; complexed with mg, zn

Details for d1pqva_

PDB Entry: 1pqv (more details), 3.8 Å

PDB Description: RNA polymerase II-TFIIS complex
PDB Compounds: (A:) DNA-directed RNA polymerase II largest subunit

SCOPe Domain Sequences for d1pqva_:

Sequence, based on SEQRES records: (download)

>d1pqva_ i.8.1.1 (A:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglkl
vgswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpv
ppppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhva
tymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnlel
dqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskra
gdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynad
fdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfi
eldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspk
dngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhng
fstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrf
lneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvd
rtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrl
vkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdl
lntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnir
riiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccl
lrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtl
ntfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaieht
tlksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldraa
mndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhmlk
kientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvpg
idptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqggl
tsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtgaf
dvmideeslvky

Sequence, based on observed residues (ATOM records): (download)

>d1pqva_ i.8.1.1 (A:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
mrqalaikdskkrfaaiwtlcktkmvcetdvpslvsrggcgntqptirkdglklvgswkl
rvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppvrpseddltfklad
ilkanisletlehngaphhaieeaesllqfhvatymdndiagqpqapvksirarlkgkeg
rirgnlmgkrvdfsartvisgdpnleldqvgvpksiaktltypevvtpynidrltqlvrn
gpnehpgakyvirdsgdridlryskragdiqlqygwkverhimdndpvlfnrqpslhkms
mmahrvkvipystfrlnlsvtspynadfdgdemnlhvpqseetraelsqlcavplqivsp
qsnkpcmgivqdtlcgirkltlrdtfieldqvlnmlywvpdwdgviptpaiikpkplwsg
kqilsvaipngihlqrfdegttllspkdngmliidgqiifgvvekktvgssngglihvvt
rekgpqvcaklfgniqkvvnfwllhngfstgigdtiadgptmreitetiaeakkkvldvt
keaqanlltakhgmtlresfednvvrflneardkagrlaevnlkdlnnvkqmvmagskgs
finiaqmsacvgqqsvegkriafgfvdrtlphfskddyspeskgfvensylrgltpqeff
fhamggreglidtavktaetgyiqrrlvkaledimvhydnttrnslgnviqfiygedgmd
aahiekqsldtiggsdaafekryrvdllntdhtldpsllesgseilgdlklqvlldeeyk
qlvkdrkflrevfvdgeanwplpvnirriiqnaqqtfhidhtkpsdltikdivlgvkdlq
enllvlrgkneiiqnaqrdavtlfccllrsrlatrrvlqeyrltkqafdwvlsnieaqfl
rsvvhpgemvgvlaaqsigepatqmtlntfhfagvaskkvtsgvprlkeilnvaknmktp
sltvylepghaadqeqaklirsaiehttlksvtiaseiyydpdprstvipedeeiiqlhf
slldeeaeqsfdqqspwllrleldraamndkdltmgqvgerikqtfkndlfviwsednde
kliircrvvaeedhmlkkientmlenitlrgveniervvmmkydrkvpsptgeyvkepew
vletdgvnlsevmtvpgidptriytnsfidimevlgieagraalykevynviasdgsyvn
yrhmallvdvmttqggltsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgv
senvilgqmapigtgafdvmideeslvky

SCOPe Domain Coordinates for d1pqva_:

Click to download the PDB-style file with coordinates for d1pqva_.
(The format of our PDB-style files is described here.)

Timeline for d1pqva_: