| Class b: All beta proteins [48724] (176 folds) |
| Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) ![]() |
| Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins) |
| Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species) autocatalytic enzyme |
| Species Escherichia coli [TaxId:562] [50695] (9 PDB entries) |
| Domain d1pqhb_: 1pqh B: [95018] unprocessed mutant complexed with mla, na; mutant |
PDB Entry: 1pqh (more details), 1.29 Å
SCOPe Domain Sequences for d1pqhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pqhb_ b.52.2.1 (B:) Pyruvoyl dependent aspartate decarboxylase, ADC {Escherichia coli [TaxId: 562]}
mirtmlqgklhrvkvthadlhyegtcaidqdfldaagileneaidiwnvtngkrfstyai
aaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemk
Timeline for d1pqhb_: