SCOP 1.75: Domain d1pqhb_: 1pqh B:

Lineage for d1pqhb_ (1pqh B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (3 families)

5. Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (1 protein)

6. Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species)
   autocatalytic enzyme

7. Species Escherichia coli [TaxId:562] [50695] (9 PDB entries)

8. Domain d1pqhb_: 1pqh B: [95018]
   unprocessed mutant

Details for d1pqhb_

PDB Entry: 1pqh, 1.29 Å

PDB Description: serine 25 to threonine mutation of aspartate decarboxylase

PDB Compounds: (B:) Aspartate 1-decarboxylase

SCOP Domain Sequences for d1pqhb_:

Sequence; same for both SEQRES and ATOM records:

>d1pqhb_ b.52.2.1 (B:) Pyruvoyl dependent aspartate decarboxylase, ADC {Escherichia coli [TaxId: 562]}
mirtmlqgklhrvkvthadlhyegtcaidqdfldaagileneaidiwnvtngkrfstyai
aaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemk

Timeline for d1pqhb_:

• d1pqhb_ first appeared in SCOP 1.67
  
• d1pqhb_ appears in SCOP 1.73
  
• d1pqhb_ appears in SCOPe 2.01
  
• d1pqhb_ appears in the current release, SCOPe 2.08