SCOPe 2.05: Domain d1pqfa_: 1pqf A:

Lineage for d1pqfa_ (1pqf A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins)

6. Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species)
   autocatalytic enzyme

7. Species Escherichia coli [TaxId:562] [50695] (9 PDB entries)

8. Domain d1pqfa_: 1pqf A: [95015]
   unprocessed mutant
   complexed with so4; mutant

Details for d1pqfa_

PDB Entry: 1pqf, 2 Å

PDB Description: glycine 24 to serine mutation of aspartate decarboxylase

PDB Compounds: (A:) Aspartate 1-decarboxylase

SCOPe Domain Sequences for d1pqfa_:

Sequence; same for both SEQRES and ATOM records:

>d1pqfa_ b.52.2.1 (A:) Pyruvoyl dependent aspartate decarboxylase, ADC {Escherichia coli [TaxId: 562]}
prgsmirtmlqgklhrvkvthadlhyesscaidqdfldaagileneaidiwnvtngkrfs
tyaiaaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemkr
takaipv

Timeline for d1pqfa_:

• d1pqfa_ first appeared in SCOP 1.67
  
• d1pqfa_ appears in SCOPe 2.04
  
• d1pqfa_ is called d1pqfa1 in SCOPe 2.06
  
• d1pqfa_ appears in the current release, SCOPe 2.08, called d1pqfa1