Lineage for d1pqfa_ (1pqf A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 377990Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 378013Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 378014Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (1 protein)
  6. 378015Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (1 species)
    autocatalytic enzyme
  7. 378016Species Escherichia coli [TaxId:562] [50695] (9 PDB entries)
  8. 378030Domain d1pqfa_: 1pqf A: [95015]

Details for d1pqfa_

PDB Entry: 1pqf (more details), 2 Å

PDB Description: glycine 24 to serine mutation of aspartate decarboxylase

SCOP Domain Sequences for d1pqfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqfa_ b.52.2.1 (A:) Pyruvoyl dependent aspartate decarboxylase, ADC {Escherichia coli}
prgsmirtmlqgklhrvkvthadlhyesscaidqdfldaagileneaidiwnvtngkrfs
tyaiaaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemkr
takaipv

SCOP Domain Coordinates for d1pqfa_:

Click to download the PDB-style file with coordinates for d1pqfa_.
(The format of our PDB-style files is described here.)

Timeline for d1pqfa_: