Lineage for d1pqfa1 (1pqf A:1-123)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802649Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2802650Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins)
  6. 2802651Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species)
    autocatalytic enzyme
  7. 2802652Species Escherichia coli [TaxId:562] [50695] (9 PDB entries)
  8. 2802666Domain d1pqfa1: 1pqf A:1-123 [95015]
    Other proteins in same PDB: d1pqfa2
    unprocessed mutant
    complexed with so4; mutant

Details for d1pqfa1

PDB Entry: 1pqf (more details), 2 Å

PDB Description: glycine 24 to serine mutation of aspartate decarboxylase
PDB Compounds: (A:) Aspartate 1-decarboxylase

SCOPe Domain Sequences for d1pqfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqfa1 b.52.2.1 (A:1-123) Pyruvoyl dependent aspartate decarboxylase, ADC {Escherichia coli [TaxId: 562]}
mirtmlqgklhrvkvthadlhyesscaidqdfldaagileneaidiwnvtngkrfstyai
aaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemkrtaka
ipv

SCOPe Domain Coordinates for d1pqfa1:

Click to download the PDB-style file with coordinates for d1pqfa1.
(The format of our PDB-style files is described here.)

Timeline for d1pqfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pqfa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1pqfb_