SCOPe 2.06: Domain d1pqea_: 1pqe A:

Lineage for d1pqea_ (1pqe A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.1: Pyruvoyl dependent aspartate decarboxylase, ADC [50693] (2 proteins)

6. Protein Pyruvoyl dependent aspartate decarboxylase, ADC [50694] (2 species)
   autocatalytic enzyme

7. Species Escherichia coli [TaxId:562] [50695] (9 PDB entries)

8. Domain d1pqea_: 1pqe A: [95014]
   unprocessed mutant
   mutant

Details for d1pqea_

PDB Entry: 1pqe, 1.95 Å

PDB Description: s25a mutant of pyruvoyl dependent aspartate decarboxylase

PDB Compounds: (A:) Aspartate 1-decarboxylase

SCOPe Domain Sequences for d1pqea_:

Sequence; same for both SEQRES and ATOM records:

>d1pqea_ b.52.2.1 (A:) Pyruvoyl dependent aspartate decarboxylase, ADC {Escherichia coli [TaxId: 562]}
mirtmlqgklhrvkvthadlhyegacaidqdfldaagileneaidiwnvtngkrfstyai
aaergsriisvngaaahcasvgdiviiasfvtmpdeeartwrpnvayfegdnemkrt

Timeline for d1pqea_:

• d1pqea_ first appeared in SCOP 1.67
  
• d1pqea_ appears in SCOPe 2.05
  
• d1pqea_ appears in SCOPe 2.07
  
• d1pqea_ appears in the current release, SCOPe 2.08