Lineage for d1pqcb_ (1pqc B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008914Protein Oxysterols receptor LXR-beta [89149] (1 species)
  7. 2008915Species Human (Homo sapiens) [TaxId:9606] [89150] (6 PDB entries)
    Uniprot P55055 219-461
  8. 2008926Domain d1pqcb_: 1pqc B: [95010]
    complexed with 444

Details for d1pqcb_

PDB Entry: 1pqc (more details), 2.8 Å

PDB Description: human lxr beta hormone receptor complexed with t0901317
PDB Compounds: (B:) oxysterols receptor lxr-beta

SCOPe Domain Sequences for d1pqcb_:

Sequence, based on SEQRES records: (download)

>d1pqcb_ a.123.1.1 (B:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
qltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrfahftelaiis
vqeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskd
dfhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqp
yveallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd

Sequence, based on observed residues (ATOM records): (download)

>d1pqcb_ a.123.1.1 (B:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
qltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadprdarqqrfahftelaiisvq
eivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddf
hraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyv
eallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd

SCOPe Domain Coordinates for d1pqcb_:

Click to download the PDB-style file with coordinates for d1pqcb_.
(The format of our PDB-style files is described here.)

Timeline for d1pqcb_: