Lineage for d1pq7a_ (1pq7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795997Protein Trypsin(ogen) [50515] (9 species)
  7. 2796552Species Fungus (Fusarium oxysporum) [TaxId:5507] [50521] (16 PDB entries)
  8. 2796558Domain d1pq7a_: 1pq7 A: [95002]
    complexed with arg, so4

Details for d1pq7a_

PDB Entry: 1pq7 (more details), 0.8 Å

PDB Description: trypsin at 0.8 a, ph5 / borax
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1pq7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pq7a_ b.47.1.2 (A:) Trypsin(ogen) {Fungus (Fusarium oxysporum) [TaxId: 5507]}
ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya

SCOPe Domain Coordinates for d1pq7a_:

Click to download the PDB-style file with coordinates for d1pq7a_.
(The format of our PDB-style files is described here.)

Timeline for d1pq7a_: