Lineage for d1pq6d_ (1pq6 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008914Protein Oxysterols receptor LXR-beta [89149] (1 species)
  7. 2008915Species Human (Homo sapiens) [TaxId:9606] [89150] (6 PDB entries)
    Uniprot P55055 219-461
  8. 2008924Domain d1pq6d_: 1pq6 D: [95001]
    complexed with 965, ipa

Details for d1pq6d_

PDB Entry: 1pq6 (more details), 2.4 Å

PDB Description: human lxr beta hormone receptor / gw3965 complex
PDB Compounds: (D:) oxysterols receptor lxr-beta

SCOPe Domain Sequences for d1pq6d_:

Sequence, based on SEQRES records: (download)

>d1pq6d_ a.123.1.1 (D:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
ltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrfahftelaiisv
qeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskdd
fhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpy
veallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwdv
h

Sequence, based on observed residues (ATOM records): (download)

>d1pq6d_ a.123.1.1 (D:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
ltaaqelmiqqlvaaqlqcnkrsfskvtpwplarqqrfahftelaiisvqeivdfakqvp
gflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhraglqvefi
npifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyveallsytrik
rpqdqlrfprmlmklvslrtlssvhseqvfalrlklppllseiwdvh

SCOPe Domain Coordinates for d1pq6d_:

Click to download the PDB-style file with coordinates for d1pq6d_.
(The format of our PDB-style files is described here.)

Timeline for d1pq6d_: