Lineage for d1pq4a_ (1pq4 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143341Family c.92.2.2: TroA-like [53811] (6 protein domains)
  6. 2143352Protein Periplasmic zinc binding protein ZnuA [102688] (1 species)
  7. 2143353Species Synechocystis sp. PCC 6803 [TaxId:1148] [102689] (1 PDB entry)
  8. 2143354Domain d1pq4a_: 1pq4 A: [94995]
    complexed with zn

Details for d1pq4a_

PDB Entry: 1pq4 (more details), 1.9 Å

PDB Description: Crystal structure of ZnuA
PDB Compounds: (A:) periplasmic binding protein component of an ABC type zinc uptake transporter

SCOPe Domain Sequences for d1pq4a_:

Sequence, based on SEQRES records: (download)

>d1pq4a_ c.92.2.2 (A:) Periplasmic zinc binding protein ZnuA {Synechocystis sp. PCC 6803 [TaxId: 1148]}
damditvsippqqyflekiggdlvrvsvlvpgnndphtyepkpqqlaalseaeayvligl
gfeqpwleklkaananmklidsaqgitplemekhdhshgeeeghddhshdghdhgsesek
ekakgalmvadphiwlsptlvkrqattiakelaeldpdnrdqyeanlaaflaelerlnqe
lgqilqplpqrkfivfhpswayfardynlvqipievegqepsaqelkqlidtakennltm
vfgetqfstksseaiaaeigagvelldplaadwssnlkavaqkianans

Sequence, based on observed residues (ATOM records): (download)

>d1pq4a_ c.92.2.2 (A:) Periplasmic zinc binding protein ZnuA {Synechocystis sp. PCC 6803 [TaxId: 1148]}
damditvsippqqyflekiggdlvrvsvlvpgnndphtyepkpqqlaalseaeayvligl
gfeqpwleklkaananmklidsaqgitplemekmvadphiwlsptlvkrqattiakelae
ldpdnrdqyeanlaaflaelerlnqelgqilqplpqrkfivfhpswayfardynlvqipi
evegqepsaqelkqlidtakennltmvfgetqfstksseaiaaeigagvelldplaadws
snlkavaqkianans

SCOPe Domain Coordinates for d1pq4a_:

Click to download the PDB-style file with coordinates for d1pq4a_.
(The format of our PDB-style files is described here.)

Timeline for d1pq4a_: