Lineage for d1pq2a_ (1pq2 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005379Protein Mammalian cytochrome p450 2c8 [101377] (1 species)
  7. 2005380Species Human (Homo sapiens) [TaxId:9606] [101378] (5 PDB entries)
  8. 2005386Domain d1pq2a_: 1pq2 A: [94987]
    complexed with hem, plm, po4

Details for d1pq2a_

PDB Entry: 1pq2 (more details), 2.7 Å

PDB Description: Crystal Structure of Human Drug Metabolizing Cytochrome P450 2C8
PDB Compounds: (A:) Cytochrome P450 2C8

SCOPe Domain Sequences for d1pq2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pq2a_ a.104.1.1 (A:) Mammalian cytochrome p450 2c8 {Human (Homo sapiens) [TaxId: 9606]}
klppgptplpiignmlqidvkdicksftnfskvygpvftvyfgmnpivvfhgyeavkeal
idngeefsgrgnspisqritkglgiissngkrwkeirrfslttlrnfgmgkrsiedrvqe
eahclveelrktkaspcdptfilgcapcnvicsvvfqkrfdykdqnfltlmkrfnenfri
lnspwiqvcnnfpllidcfpgthnkvlknvaltrsyirekvkehqasldvnnprdfidcf
likmeqekdnqksefnienlvgtvadlfvagtettsttlryglllllkhpevtakvqeei
dhvigrhrspcmqdrshmpytdavvheiqrysdlvptgvphavttdtkfrnylipkgtti
malltsvlhddkefpnpnifdpghfldkngnfkksdyfmpfsagkricageglarmelfl
flttilqnfnlksvddlknlnttavtkgivslppsyqicfipv

SCOPe Domain Coordinates for d1pq2a_:

Click to download the PDB-style file with coordinates for d1pq2a_.
(The format of our PDB-style files is described here.)

Timeline for d1pq2a_: