SCOPe 2.05: Domain d1ppqa_: 1ppq A:

Lineage for d1ppqa_ (1ppq A:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement receptor 1, cr1 [75680] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75681] (3 PDB entries)

8. Domain d1ppqa_: 1ppq A: [94980]
   module 16

Details for d1ppqa_

PDB Entry: 1ppq

PDB Description: nmr structure of 16th module of immune adherence receptor, cr1 (cd35)

PDB Compounds: (A:) complement receptor type 1

SCOPe Domain Sequences for d1ppqa_:

Sequence; same for both SEQRES and ATOM records:

>d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]}
eaeakscktppdpvngmvhvitdiqvgsrityscttghrlighssaecilsgntahwstk
ppicqrip

Timeline for d1ppqa_:

• d1ppqa_ first appeared in SCOP 1.67
  
• d1ppqa_ appears in SCOPe 2.04
  
• d1ppqa_ is called d1ppqa1 in SCOPe 2.06
  
• d1ppqa_ appears in the current release, SCOPe 2.08, called d1ppqa1