Lineage for d1pp8m_ (1pp8 M:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351617Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) (S)
    contains a small beta-sheet (wing)
  5. 352159Family a.4.5.44: 39 kda initiator binding protein, IBP39, N-terminal domain [101045] (1 protein)
  6. 352160Protein 39 kda initiator binding protein, IBP39, N-terminal domain [101046] (1 species)
  7. 352161Species Trichomonas vaginalis [TaxId:5722] [101047] (2 PDB entries)
  8. 352164Domain d1pp8m_: 1pp8 M: [94975]

Details for d1pp8m_

PDB Entry: 1pp8 (more details), 3.05 Å

PDB Description: crystal structure of the T. vaginalis IBP39 Initiator binding domain (IBD) bound to the alpha-SCS Inr element

SCOP Domain Sequences for d1pp8m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp8m_ a.4.5.44 (M:) 39 kda initiator binding protein, IBP39, N-terminal domain {Trichomonas vaginalis}
mdsndleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswi
sdtefkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftrnsvfed

SCOP Domain Coordinates for d1pp8m_:

Click to download the PDB-style file with coordinates for d1pp8m_.
(The format of our PDB-style files is described here.)

Timeline for d1pp8m_: