SCOP 1.73: Domain d1pp4b_: 1pp4 B:

Lineage for d1pp4b_ (1pp4 B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (7 families)

5. Family c.23.10.4: Rhamnogalacturonan acetylesterase [52276] (1 protein)

6. Protein Rhamnogalacturonan acetylesterase [52277] (1 species)

7. Species Fungus (Aspergillus aculeatus) [TaxId:5053] [52278] (4 PDB entries)

8. Domain d1pp4b_: 1pp4 B: [94971]
   complexed with nag

Details for d1pp4b_

PDB Entry: 1pp4, 2.5 Å

PDB Description: the crystal structure of rhamnogalacturonan acetylesterase in space group p3121

PDB Compounds: (B:) Rhamnogalacturonan acetylesterase

SCOP Domain Sequences for d1pp4b_:

Sequence; same for both SEQRES and ATOM records:

>d1pp4b_ c.23.10.4 (B:) Rhamnogalacturonan acetylesterase {Fungus (Aspergillus aculeatus) [TaxId: 5053]}
ttvylagdstmakngggsgtngwgeylasylsatvvndavagrsarsytregrfeniadv
vtagdyvivefghndggslstdngrtdcsgtgaevcysvydgvnetiltfpaylenaakl
ftakgakvilssqtpnnpwetgtfvnsptrfveyaelaaevagveyvdhwsyvdsiyetl
gnatvnsyfpidhthtspagaevvaeaflkavvctgtslksvltttsfegtcl

Timeline for d1pp4b_:

• d1pp4b_ first appeared in SCOP 1.67
  
• d1pp4b_ appears in SCOP 1.71
  
• d1pp4b_ appears in SCOP 1.75
  
• d1pp4b_ appears in the current release, SCOPe 2.08