Lineage for d1pp1x_ (1pp1 X:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014763Fold a.206: P40 nucleoprotein [101398] (1 superfamily)
    multihelical; consists of two subdomains
  4. 2014764Superfamily a.206.1: P40 nucleoprotein [101399] (1 family) (S)
    automatically mapped to Pfam PF06407
  5. 2014765Family a.206.1.1: P40 nucleoprotein [101400] (1 protein)
  6. 2014766Protein P40 nucleoprotein [101401] (1 species)
  7. 2014767Species Borna disease virus [TaxId:12455] [101402] (2 PDB entries)
  8. 2014769Domain d1pp1x_: 1pp1 X: [94969]

Details for d1pp1x_

PDB Entry: 1pp1 (more details), 1.9 Å

PDB Description: Crystal structure of the Borna Disease Virus Nucleoprotein
PDB Compounds: (X:) p40 nucleoprotein

SCOPe Domain Sequences for d1pp1x_:

Sequence, based on SEQRES records: (download)

>d1pp1x_ a.206.1.1 (X:) P40 nucleoprotein {Borna disease virus [TaxId: 12455]}
klpgkflqytvggsdphpgighekdirqnavalldqsrrdmfhtvtpslvflcllipglh
aafvhggvpresylstpvtrgeqtvvktakfygekttqrdlteleissifshccslligv
vigssskikagaeqikkrfktmmaalnrpshgetatllqmfnpheaidwingqpwvgsfv
lsllttdfespgkefmdqiklvasyaqmttyttikeylaecmdatltipvvayeirdfle
vsaklkedhadlfpflgairhpdaiklaprsfpnlasaafywskkenptmagyrastiqp
gasvketqlaryrrreisrgedgaelsgeisaimkmigvtgln

Sequence, based on observed residues (ATOM records): (download)

>d1pp1x_ a.206.1.1 (X:) P40 nucleoprotein {Borna disease virus [TaxId: 12455]}
klpgkflqytvggsdphpgighekdirqnavalldqsrrdmfhtvtpslvflcllipglh
aafvhggvpresylstpvtrgeqtvvktakfygekttqrdlteleissifshccslligv
vigssskikagaeqikkrfktmmaalnrpshgetatllqmfnpheaidwingqpwvgsfv
lsllttdfespgkefmdqiklvasyaqmttyttikeylaecmdatltipvvayeirdfle
vsaklkedhadlfpflgairhpdaiklaprsfpnlasaafywskkenstiqpgasvketq
laryrrreisrgedgaelsgeisaimkmigvtgln

SCOPe Domain Coordinates for d1pp1x_:

Click to download the PDB-style file with coordinates for d1pp1x_.
(The format of our PDB-style files is described here.)

Timeline for d1pp1x_: