Lineage for d1poqa_ (1poq A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2412178Fold b.135: Superantigen (mitogen) Ypm [101605] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2412179Superfamily b.135.1: Superantigen (mitogen) Ypm [101606] (1 family) (S)
    automatically mapped to Pfam PF09144
  5. 2412180Family b.135.1.1: Superantigen (mitogen) Ypm [101607] (1 protein)
  6. 2412181Protein Superantigen (mitogen) Ypm [101608] (1 species)
  7. 2412182Species Yersinia pseudotuberculosis [TaxId:633] [101609] (2 PDB entries)
  8. 2412186Domain d1poqa_: 1poq A: [94967]

Details for d1poqa_

PDB Entry: 1poq (more details)

PDB Description: Solution Structure of a Superantigen from Yersinia pseudotuberculosis
PDB Compounds: (A:) ypm

SCOPe Domain Sequences for d1poqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poqa_ b.135.1.1 (A:) Superantigen (mitogen) Ypm {Yersinia pseudotuberculosis [TaxId: 633]}
ripniatytgtiqgkgevciignkegktrggelyavlhstnvnadmtlillrnvggngwg
eikrndidkplkyedyytsglswiwkiknnssetsnysldatvhddkedsdvltkcpv

SCOPe Domain Coordinates for d1poqa_:

Click to download the PDB-style file with coordinates for d1poqa_.
(The format of our PDB-style files is described here.)

Timeline for d1poqa_: