Lineage for d1po8a_ (1po8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733143Species Indian krait (Bungarus caeruleus), different isoforms [TaxId:132961] [48636] (7 PDB entries)
    Uniprot Q6SLM1 # fragment; Uniprot Q9DF52 28-145 # ! 74% sequence identity
  8. 2733150Domain d1po8a_: 1po8 A: [94966]
    complexed with na, shv

Details for d1po8a_

PDB Entry: 1po8 (more details), 2.71 Å

PDB Description: Crystal structure of a complex formed between krait venom phospholipase A2 and heptanoic acid at 2.7 A resolution.
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1po8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1po8a_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]}
nlyqlmnmiqcantrtwpsytnygcycgkggsgtpvddldrccythdhcyndaknidgcn
pvtktysytcteptitcndskdkcarfvcdcdrtaaicfakapyntsnvmirstnscq

SCOPe Domain Coordinates for d1po8a_:

Click to download the PDB-style file with coordinates for d1po8a_.
(The format of our PDB-style files is described here.)

Timeline for d1po8a_: