Lineage for d1po3a_ (1po3 A:)

  1. Root: SCOP 1.71
  2. 619386Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)
  3. 619518Fold f.4: Transmembrane beta-barrels [56924] (6 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 619555Superfamily f.4.3: Porins [56935] (4 families) (S)
  5. 619628Family f.4.3.3: Ligand-gated protein channel [56948] (4 proteins)
    monomeric (22,24) barrel; ~150 N-terminal residues form a "plug" or "cork" subdomain
  6. 619650Protein Outer membrane transporter FecA [75654] (1 species)
  7. 619651Species Escherichia coli [TaxId:562] [75655] (5 PDB entries)
  8. 619656Domain d1po3a_: 1po3 A: [94961]

Details for d1po3a_

PDB Entry: 1po3 (more details), 3.4 Å

PDB Description: Crystal structure of ferric citrate transporter FecA in complex with ferric citrate

SCOP Domain Sequences for d1po3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1po3a_ f.4.3.3 (A:) Outer membrane transporter FecA {Escherichia coli}
ndvfehagardvirredfaktgattmrevlnripgvsapenngtgshdlamnfgirglnp
rlasrstvlmdgipvpfapygqpqlslapvslgnmdaidvvrgggavrygpqsvggvvnf
vtraipqdfgieagvegqlsptssqnnpkethnlmvggtadngfgtallysgtrgsdwre
hsatriddlmlkskyapdevhtfnsllqyydgeadmpgglsradydadrwqstrpydrfw
grrklaslgyqfqpdsqhkfniqgfytqtlrsgyleqgkritlsprnywvrgieprysqi
fmigpsahevgvgyrylnesthemryytatssgqlpsgsspydrdtrsgteahawylddk
idignwtitpgmrfehiesyqnnaitgtheevsynaplpalnvlyhltdswnlyantegs
fgtvqysqigkavqsgnvepekartwelgtryddgaltaemglflinfnnqydsnqtndt
vtargktrhtgletqarydlgtltptldnvsiyasyayvnaeirekgdtygnlvpfspkh
kgtlgvdykpgnwtfnlnsdfqssqfadnantvkesadgstgripgfmlwgarvaydfgp
qmadlnlafgvknifdqdyfirsyddnnkgiyagqprtlymqgslkf

SCOP Domain Coordinates for d1po3a_:

Click to download the PDB-style file with coordinates for d1po3a_.
(The format of our PDB-style files is described here.)

Timeline for d1po3a_: