Lineage for d1pnza_ (1pnz A:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2251383Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2251501Superfamily f.4.3: Porins [56935] (5 families) (S)
  5. 2251661Family f.4.3.3: Ligand-gated protein channel [56948] (5 proteins)
    monomeric (22,24) barrel; ~150 N-terminal residues form a "plug" or "cork" subdomain
  6. 2251692Protein Outer membrane transporter FecA [75654] (1 species)
  7. 2251693Species Escherichia coli [TaxId:562] [75655] (5 PDB entries)
  8. 2251696Domain d1pnza_: 1pnz A: [94959]

Details for d1pnza_

PDB Entry: 1pnz (more details), 2.5 Å

PDB Description: Crystal structure of ferric citrate transporter FecA in the unliganded form
PDB Compounds: (A:) Iron(III) dicitrate transport protein fecA precursor

SCOPe Domain Sequences for d1pnza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnza_ f.4.3.3 (A:) Outer membrane transporter FecA {Escherichia coli [TaxId: 562]}
altvvgdwlgdarendvfehagardvirredfaktgattmrevlnripgvsapenngtgs
hdlamnfgirglnprlasrstvlmdgipvpfapygqpqlslapvslgnmdaidvvrggga
vrygpqsvggvvnfvtraipqdfgieagvegqlsptssqnnpkethnlmvggtadngfgt
allysgtrgsdwrehsatriddlmlkskyapdevhtfnsllqyydgeadmpgglsradyd
adrwqstrpydrfwgrrklaslgyqfqpdsqhkfniqgfytqtlrsgyleqgkritlspr
nywvrgieprysqifmigpsahevgvgyrylnesthemryytatssgqlpsgsspydrdt
rsgteahawylddkidignwtitpgmrfehiesyqnnaitgtheevsynaplpalnvlyh
ltdswnlyantegsfgtvqysqigkavqsgnvepekartwelgtryddgaltaemglfli
nfnnqydsnqtndtvtargktrhtgletqarydlgtltptldnvsiyasyayvnaeirek
gdtygnlvpfspkhkgtlgvdykpgnwtfnlnsdfqssqfadnantvkesadgstgripg
fmlwgarvaydfgpqmadlnlafgvknifdqdyfirsyddnnkgiyagqprtlymqgslk
f

SCOPe Domain Coordinates for d1pnza_:

Click to download the PDB-style file with coordinates for d1pnza_.
(The format of our PDB-style files is described here.)

Timeline for d1pnza_: