Lineage for d1pnvb_ (1pnv B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 494078Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 494079Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (8 families) (S)
  5. 494245Family c.87.1.5: Gtf glycosyltransferase [64178] (3 proteins)
    Glycosyltransferase family 28
  6. 494246Protein TDP-epi-vancosaminyltransferase GtfA [102680] (1 species)
  7. 494247Species Amycolatopsis orientalis [TaxId:31958] [102681] (2 PDB entries)
  8. 494251Domain d1pnvb_: 1pnv B: [94958]

Details for d1pnvb_

PDB Entry: 1pnv (more details), 2.8 Å

PDB Description: crystal structure of tdp-epi-vancosaminyltransferase gtfa in complexes with tdp and vancomycin

SCOP Domain Sequences for d1pnvb_:

Sequence, based on SEQRES records: (download)

>d1pnvb_ c.87.1.5 (B:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis}
mrvlitgcgsrgdteplvalaarlrelgadarmclppdyvercaevgvpmvpvgravrag
arepgelppgaaevvtevvaewfdkvpaaiegcdavvttgllpaavavrsmaeklgipyr
ytvlspdhlpseqsqaerdmynqgadrlfgdavnshrasiglppvehlydygytdqpwla
adpvlsplrptdlgtvqtgawilpderplsaeleaflaagstpvyvgfgsssrpatadaa
kmaikavrasgrrivlsrgwadlvlpddgadcfvvgevnlqelfgrvaaaihhdsagttl
lamragipqivvrrvvdnvveqayhadrvaelgvgvavdgpvptidslsaaldtalapei
rarattvadtiradgttvaaqllfdavslek

Sequence, based on observed residues (ATOM records): (download)

>d1pnvb_ c.87.1.5 (B:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis}
mrvlitgcgsrgdteplvalaarlrelgadarmclppdyvercaevgvpmvpvgravrag
arepgelppgaaevvtevvaewfdkvpaaiegcdavvttgllpaavavrsmaeklgipyr
ytvlspdhlpseqsqaerdmynqgadrlfgdavnshrasiglppvehlydygytdqpwla
adpvlsplrptdlgtvqtgawilpderplsaeleaflaagstpvyvgfgsssrpatadaa
kmaikavrasgrrivlsrgwadlvlpddgadcfvvgevnlqelfgrvaaaihhdsagttl
lamragipqivvrrvayhadrvaelgvgvavdgpvptidslsaaldtalapeirarattv
adtiradgttvaaqllfdavslek

SCOP Domain Coordinates for d1pnvb_:

Click to download the PDB-style file with coordinates for d1pnvb_.
(The format of our PDB-style files is described here.)

Timeline for d1pnvb_: