SCOP 1.69: Domain d1pnqa_: 1pnq A:

Lineage for d1pnqa_ (1pnq A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein)
   binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode

6. Protein Transhydrogenase domain III (dIII) [52485] (3 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [52488] (6 PDB entries)

8. Domain d1pnqa_: 1pnq A: [94955]

Details for d1pnqa_

PDB Entry: 1pnq, 2.4 Å

PDB Description: Crystal structure of R. rubrum transhydrogenase domain III bound to NADPH

SCOP Domain Sequences for d1pnqa_:

Sequence; same for both SEQRES and ATOM records:

>d1pnqa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum}
sghiegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsya
ihpvagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdps
spiygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

Timeline for d1pnqa_:

• d1pnqa_ first appeared in SCOP 1.67
  
• d1pnqa_ appears in SCOP 1.71
  
• d1pnqa_ appears in the current release, SCOPe 2.08, called d1pnqa1