Lineage for d1pnqa_ (1pnq A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 392797Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 392798Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (5 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 392894Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (1 protein)
    binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
  6. 392895Protein Transhydrogenase domain III (dIII) [52485] (3 species)
  7. 392903Species Rhodospirillum rubrum [TaxId:1085] [52488] (6 PDB entries)
  8. 392906Domain d1pnqa_: 1pnq A: [94955]

Details for d1pnqa_

PDB Entry: 1pnq (more details), 2.4 Å

PDB Description: Crystal structure of R. rubrum transhydrogenase domain III bound to NADPH

SCOP Domain Sequences for d1pnqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnqa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum}
sghiegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsya
ihpvagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdps
spiygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

SCOP Domain Coordinates for d1pnqa_:

Click to download the PDB-style file with coordinates for d1pnqa_.
(The format of our PDB-style files is described here.)

Timeline for d1pnqa_: