Lineage for d1pnoa_ (1pno A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843167Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 1843168Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 1843396Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins)
    binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
    automatically mapped to Pfam PF02233
  6. 1843397Protein Transhydrogenase domain III (dIII) [52485] (3 species)
  7. 1843407Species Rhodospirillum rubrum [TaxId:1085] [52488] (15 PDB entries)
  8. 1843408Domain d1pnoa_: 1pno A: [94953]
    complexed with nap

Details for d1pnoa_

PDB Entry: 1pno (more details), 2.1 Å

PDB Description: Crystal structure of R. rubrum transhydrogenase domain III bound to NADP
PDB Compounds: (A:) NAD(P) transhydrogenase subunit beta

SCOPe Domain Sequences for d1pnoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnoa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]}
sghiegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsya
ihpvagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdps
spiygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

SCOPe Domain Coordinates for d1pnoa_:

Click to download the PDB-style file with coordinates for d1pnoa_.
(The format of our PDB-style files is described here.)

Timeline for d1pnoa_:

Domains from other chains:
(mouse over for more information)
d1pnob_