Lineage for d1pnoa_ (1pno A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-likeSuperfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) 
binds cofactor molecules in the opposite direction than classical Rossmann fold
Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins)
binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
automatically mapped to Pfam PF02233Protein Transhydrogenase domain III (dIII) [52485] (3 species) 
Species Rhodospirillum rubrum [TaxId:1085] [52488] (15 PDB entries) 
Domain d1pnoa_: 1pno A: [94953]
complexed with nap
Details for d1pnoa_
PDB Entry: 1pno (more details), 2.1 Å
PDB Description: Crystal structure of R. rubrum transhydrogenase domain III bound to NADP
PDB Compounds: (A:) NAD(P) transhydrogenase subunit betaSCOPe Domain Sequences for d1pnoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pnoa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]}
sghiegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsya
ihpvagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdps
spiygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
SCOPe Domain Coordinates for d1pnoa_:
Click to download the PDB-style file with coordinates for d1pnoa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pnoa_:
- d1pnoa_ first appeared in SCOP 1.67
- d1pnoa_ appears in SCOPe 2.04
- d1pnoa_ is called d1pnoa1 in SCOPe 2.06
- d1pnoa_ appears in the current release, SCOPe 2.08, called d1pnoa1
View in 3D
